InSilicoSpectro::InSilico::IsoelPoint - A class for peptide isoelectric point (pI) prediction
use InSilicoSpectro::InSilico::IsoelPoint; # create a isoelectric point predictor my $pi = InSilicoSpectro::InSilico::IsoelPoint->new; # predict isoelectric point for a peptide $pi->predict( peptide=>'ACFGDMKWVTFISLLRPLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE' ); # calibrate the predictor $pi->calibrate( data=>{calseqs=>\@calseqs,caltimes=>\@caltimes,calmodifs=>\@calmodifs},calibrator=>$ec );
InSilicoSpectro::InSilico::IsoelPoint is a class for predicting the isoelectric point of peptides. It gives also a method for calibration of the predictor.
$h contains a hash with parameters.
Predict the isoelectric point.
Calibrate the predictor.
Save current calibrator.
Retrieve a previously saved calibrator.
Set an instance parameter.
Get an instance parameter.
Returns a pointer to an array of available authors param set for a given method (such as as 'iterative')
see InSilicoSpectro/t/InSilico/testIsoelPoint.pl script
InSilicoSpectro::InSilico::ExpCalibrator
InSilicoSpectro::InSilico::RetentionTimer
Copyright (C) 2004-2005 Geneva Bioinformatics www.genebio.com
This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version.
This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details.
You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
Pablo Carbonell, Alexandre Masselot, www.genebio.com
To install InSilicoSpectro, copy and paste the appropriate command in to your terminal.
cpanm
cpanm InSilicoSpectro
CPAN shell
perl -MCPAN -e shell install InSilicoSpectro
For more information on module installation, please visit the detailed CPAN module installation guide.