NAME

InSilicoSpectro::InSilico::RetentionTimer::Petritis Prediction of peptide retention time by neural network training

SYNOPSIS

  # creates a retention time predictor
  my $rt = InSilicoSpectro::InSilico::RetentionTimer::Petritis->new;

  # trains the predictor
  $rt->learn( data=>{expseqs=>['ELGFQG','HPGDFGADAQAAMSK','LSSPATLNSR','RFIK'],
              exptimes=>[1314,1194,1152,1500]},mode=>'verbose',
              maxepoch=>100, sqrerror=>1e-3,mode=>'verbose',
              nnet=>{learningrate=>0.05},layers=>[{nodes=>20},{nodes=>2},{nodes=>1}] );

  # predicts retention time for a peptide
  $rt->predict( peptide=>'ACFGDMKWVTFISLLRPLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE' );

  # saves the network
  $rt->write_xml(confile=>'nnet01.xml');

  # retrieves a previously saved network
  $rt->read_xml(confile=>'nnet00.xml');

  # assigns a calibrator to the predictor
  $ec=InSilicoSpectro::InSilico::ExpCalibrator->new( fitting=>'spline' );

  # fits the calibrator from expermiental values
  $rt->calibrate( data=>{calseqs=>['ELGFQG','HPGDFGADAQAAMSK','LSSPATLNSR','RFIK'],
                 caltimes=>[1314,1194,1152,1500]},calibrator=>$ec );

  # save current calibrator
  $rt->write_cal( calfile=>$file );

  # retrieve previously saved calibrator
  $rt->read_cal ( calfile=>$file );

DESCRIPTION

Predicts HPLC retention time for peptides

METHODS

my $rt=InSilicoSpectro::InSilico::RetentionTimer::Petritis->new(%h )

%h contains a hash

$rt->learn( data=>{expseqs=>\@seqs,exptimes=>\@times}, mode=>'verbose',maxepoch=>100, sqrerror=>1e-3,mode=>'verbose', nnet=>{learningrate=>0.05},layers=>[{nodes=>20},{nodes=>2},{nodes=>1}] ); );

Trains the network from experimental data given in the arrays (@seqs,@times).

maxepoch, sqrerror : train the network until sse < sqrerror or maxepoch

nnet=>{%h} : hash with options for method AI::NNFlex::Backprop->new( %h )

layers=>[{%h1},{%h2},{%h3}] : hashes with options for the 3 layers as defined by method AI::NNFlex::Backprop->add_layer( %hi )

mode=>'silent'|'verbose'

Method used for fitting

$rt->predict(peptide=>$str)

Predicts retention time for the peptide

$rt->predictor(peptide=>$str)

Same as predict() but without experimental fitting

$rt->calibrate( data=>{calseqs=>\@str,caltimes=>\@val},fitting=>$str );

Trains the predictor with experimental data and the chosen fitting method

fitting=>'linear'|'spline'

Method used for fitting

$rc->filter( filter=>$pc,error=>$str )

Filter experimental data in $rc->{data} by a cutting threshold of relative prediction error of $pc (in %).

error=>'relative'|'absolute'

Type of error for filtering.

$rt->writexml( confile=>$file )

Saves network into a file

$rt->readxml( confile=>$file )

Retrieves a previously saved network

$rt->write_cal( calfile=>$file );

Save current calibrator.

$rt->read_cal ( calfile=>$file );

Retrieve a previously saved calibrator.

$rt->set($name, $val)

Set an instance paramter.

$rt->get($name)

Get an instance parameter.

EXAMPLES

see InSilicoSpectro/t/InSilico/testPetritis.pl script

SEE ALSO

InSilicoSpectro::InSilico::RetentionTimer

InSilicoSpectro::InSilico::ExpCalibrator

Petritis K, Kangas LJ, Ferguson PL, Anderson GA, Pasa-Tolic L, Lipton MS, Auberry KJ, Strittmatter EF, Shen Y, Zhao R, Smith RD. "Use of artificial neural networks for the accurate prediction of peptide liquid chromatography elution times in proteome analyses". Anal Chem. 2003; 75(5):1039-48.

COPYRIGHT

Copyright (C) 2004-2005 Geneva Bioinformatics www.genebio.com

This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version.

This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details.

You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA

AUTHORS

Pablo Carbonell, Alexandre Masselot, www.genebio.com

cpanm InSilicoSpectro

perl -MCPAN -e shell
install InSilicoSpectro